HORDB

ID: hor006698
Uniprot ID: Q9PW66(20-96)
Protein name: Prokineticin Bv8
Gene name: NA
Organism: Bombina variegata (Yellow-bellied toad)
Family: AVIT (prokineticin) family
Source: animal
Expression: Expressed by the skin glands.
Disease: NA
Comments: NA
Taxonomy: Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0090729 toxin activity
GO BP: GO:0035821 modulation of process of another organism
GO CC: GO:0005576 extracellular region

Sequence: AVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS
Length: 77(20-96)
Propeptide: MKCFAQIVVLLLVIAFSHGAVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS
Signal peptide: MKCFAQIVVLLLVIAFSHG
Modification: NA
Glycosylation: NA
Mutagenesis: 1-5Missing: Does not activate prokineticin receptor 2.

Function: Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2, and inducer of a potent and long-lasting hyperalgesia (PubMed:16299550, PubMed:20677202). Shows an EC(50) of 0.264 nM, when tested on neuroblastoma cells (SH-SY5Y) which endogenously express mainly PKR2
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

2kra.pdb

hor006698_AF2.pdb

hor006698_ESM.pdb

Mass:	938598	Formula:	C335H539N101O108S10
Absent amino acids:	M	Common amino acids:	SC
pI:	8.27	Basic residues:	12
Polar residues:	35	Hydrophobic residues:	19
Hydrophobicity:	-24.29	Boman Index:	-11947
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.55
Instability Index:	4056.1	Extinction Coefficient cystines:	7615
Absorbance 280nm:	100.2

PubMed ID: 10422759
Title: Bv8, a small protein from frog skin and its homologue from snake venom induce hyperalgesia in rats.
PubMed ID: 12466223
Title: Nociceptive sensitization by the secretory protein Bv8.
PubMed ID: 16299550
Title: Bv8, the amphibian homologue of the mammalian prokineticins, induces a proinflammatory phenotype
PubMed ID: 16687502
Title:
PubMed ID: 20677202
Title: